Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-32 , porcine

The source of Brain natriuretic peptide-32 is pig (Sus scrofa) .

Product Specifications

Purity

≥95%

Molecular Weight

3570.17

Notes

For research use only.

AA Sequence

SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys10-Cys26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-E. coli Stx2B (URoom Temperatureoxazumab)-SMCC-DM1 ADC
ADC-W-2138 1 mg

Anti-E. coli Stx2B (URoom Temperatureoxazumab)-SMCC-DM1 ADC

Sign In for Pricing
View Details
Quick Step Rat thrombospondin 1, TSP-1 ELISA Kit
QS0677Ra-01 48 Tests

Quick Step Rat thrombospondin 1, TSP-1 ELISA Kit

Sign In for Pricing
View Details
Quick Step Rat thrombospondin 1, TSP-1 ELISA Kit
QS0677Ra-02 96 Tests

Quick Step Rat thrombospondin 1, TSP-1 ELISA Kit

Sign In for Pricing
View Details
Caprisil NH2-E HPLC Column, 3 µm, 100 Å, CY533-AE x 75 mm
CY533-AE 3 µm

Caprisil NH2-E HPLC Column, 3 µm, 100 Å, CY533-AE x 75 mm

Sign In for Pricing
View Details
Goose Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit
MBS9373196 Inquire

Goose Apolipoprotein A1 Antibody (Anti-APOA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4062) [DyLight 488]
NBP3-08522G 100 µL

Mouse Monoclonal Intelectin-1/Omentin Antibody (ITLN1/4062) [DyLight 488]

Sign In for Pricing
View Details