Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-32 , porcine

The source of Brain natriuretic peptide-32 is pig (Sus scrofa) .

Product Specifications

Purity

≥95%

Molecular Weight

3570.17

Notes

For research use only.

AA Sequence

SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys10-Cys26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tpte (NM_199257) AAV Particle
MR214933A1V 250 µL

Mouse Tpte (NM_199257) AAV Particle

Sign In for Pricing
View Details
ITPA Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV686213 1.0 µg DNA

ITPA Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ADAT1 Protein Vector (Mouse) (pPM-C-HA)
11381024 500 ng

ADAT1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PKNOX1 (NM_004571) Human Over-expression Lysate
LY401453 100 µg

PKNOX1 (NM_004571) Human Over-expression Lysate

Sign In for Pricing
View Details
GOT2 Polyclonal Antibody, Biotin Conjugated
bs-10557R-Biotin 100 µL

GOT2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Vmn1r170 (NM_001166722) Mouse Tagged ORF Clone Lentiviral Particle
MR221371L4V 200 µL

Vmn1r170 (NM_001166722) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details