Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-32 , porcine

The source of Brain natriuretic peptide-32 is pig (Sus scrofa) .

Product Specifications

Purity

≥95%

Molecular Weight

3570.17

Notes

For research use only.

AA Sequence

SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge:Cys10-Cys26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMP Protein (N-GST & C-His, Mus musculus (Mouse) )
P501210 100 µg

CAMP Protein (N-GST & C-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
CEP192 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb940205 100 µL

CEP192 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Rabbit Monoclonal Hydroxyacid Oxidase-1/HAO-1 Antibody (001) [PE]
NBP2-90046PE 0.1 mL

Rabbit Monoclonal Hydroxyacid Oxidase-1/HAO-1 Antibody (001) [PE]

Sign In for Pricing
View Details
Recombinant HPV-11 E4 (aa 1-108) Protein
VAng-Wyb3008-1mgEcoli 1 mg (E. coli)

Recombinant HPV-11 E4 (aa 1-108) Protein

Sign In for Pricing
View Details
DSCAM Human shRNA Plasmid Kit (Locus ID 1826)
TR304905 1 Kit

DSCAM Human shRNA Plasmid Kit (Locus ID 1826)

Sign In for Pricing
View Details
YPEL1 Protein Vector (Human) (pPM-C-HA)
PV046727 500 ng

YPEL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details