Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF, ovine

GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH) .

Product Specifications

Purity

≥95%

Molecular Weight

5121.9

Notes

For research use only.

AA Sequence

YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Amino-2-phenoxypropanoic acid hydrochloride
DXC56098-01 50 mg

3-Amino-2-phenoxypropanoic acid hydrochloride

Sign In for Pricing
View Details
3-Amino-2-phenoxypropanoic acid hydrochloride
DXC56098-02 0.5 g

3-Amino-2-phenoxypropanoic acid hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Ecm1 shRNA (UAS) - Lentiviral mouse Ecm1 shRNA (UAS) (100)
GTR15184242 1 Vial

Lentiviral mouse Ecm1 shRNA (UAS) - Lentiviral mouse Ecm1 shRNA (UAS) (100)

Sign In for Pricing
View Details
OGDH Rabbit Polyclonal Antibody (PE)
orb2589020 100 µg

OGDH Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
GPR19 (N-term) Mouse Monoclonal Antibody [Clone ID: 1B5]
AM26719PU-N 200 µg

GPR19 (N-term) Mouse Monoclonal Antibody [Clone ID: 1B5]

Sign In for Pricing
View Details
TRAP1-set siRNA/shRNA/RNAi Lentivector (Human)
47509091 4x 500 ng

TRAP1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details