GHRF, ovine
GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH) .
Product Specifications
Purity
≥95%
Molecular Weight
5121.9
Notes
For research use only.
AA Sequence
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
138185-ML405 100 µL
NOLC1 (KIAA0035, Nucleolar and Coiled-Body Phosphoprotein 1, Nucleolar Phosphoprotein p130, Nucleolar 130kD Protein, 140kD Nucleolar Phosphoprotein, Nopp140, Hepatitis C Virus NS5A-Transactivated Protein 13, HCV NS5A-Transactivated Protein 13, NS5ATP13) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS2557044-01 3 mL
2-Step Plus Poly-HRP Anti Goat IgG Detection System
Sign In for Pricing
View Details 
MBS2557044-02 6 mL
2-Step Plus Poly-HRP Anti Goat IgG Detection System
Sign In for Pricing
View Details MBS2557044-03 18 mL
2-Step Plus Poly-HRP Anti Goat IgG Detection System
Sign In for Pricing
View Details 
MBS2557044-04 5x 18 mL
2-Step Plus Poly-HRP Anti Goat IgG Detection System
Sign In for Pricing
View Details GTR15150601 1 Vial
Lentiviral mouse H2-DMb2 shRNA (UAS) - Lentiviral mouse H2-DMb2 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details