GHRF, ovine
GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH) .
Product Specifications
Purity
≥95%
Molecular Weight
5121.9
Notes
For research use only.
AA Sequence
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8424266-01 0.12 mL
Rabbit Anti Human PBEF/NAMPT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC, Immunofluorescence)
Sign In for Pricing
View Details 
MBS8424266-02 0.2 mL
Rabbit Anti Human PBEF/NAMPT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC, Immunofluorescence)
Sign In for Pricing
View Details MBS8424266-03 5x 0.2 mL
Rabbit Anti Human PBEF/NAMPT Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, IHC, Immunofluorescence)
Sign In for Pricing
View Details 