GHRF, ovine
GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH) .
Product Specifications
Purity
≥95%
Molecular Weight
5121.9
Notes
For research use only.
AA Sequence
YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15139215 1 Vial
Lentiviral human C2orf83 shRNA (UAS) - Lentiviral human C2orf83 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
PH37774M5 20 µg
Centaurin beta 2 (ACAP2) (NM_012287) Human Recombinant Protein
Sign In for Pricing
View Details