Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF, ovine

GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH) .

Product Specifications

Purity

≥95%

Molecular Weight

5121.9

Notes

For research use only.

AA Sequence

YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pythiDC
563631 50.0mg

pythiDC

Sign In for Pricing
View Details
OR5L2 (N-term) Rabbit pAb
E2611455 100 µL

OR5L2 (N-term) Rabbit pAb

Sign In for Pricing
View Details
Anti-FMIP THOC5 Antibody
B2021943 100 µL

Anti-FMIP THOC5 Antibody

Sign In for Pricing
View Details
Tubb1 sgRNA CRISPR Lentivector set (Mouse)
K3248801 3x 1.0 µg

Tubb1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SMPDL3B (NM_014474) Human Over-expression Lysate
LC415256 20 µg

SMPDL3B (NM_014474) Human Over-expression Lysate

Sign In for Pricing
View Details
SNS-032 (BMS-387032)
C07556-01 5 mg

SNS-032 (BMS-387032)

Sign In for Pricing
View Details