Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-45 , rat

Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

Product Specifications

Purity

≥95%

Molecular Weight

5040.79

Notes

For research use only.

AA Sequence

SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys23-Cys39)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)
MBS1238540-01 0.02 mg (E-Coli)

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)

Sign In for Pricing
View Details
Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)
MBS1238540-02 0.1 mg (E-Coli)

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)

Sign In for Pricing
View Details
Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)
MBS1238540-03 0.02 mg (Yeast)

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)

Sign In for Pricing
View Details
Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)
MBS1238540-04 0.1 mg (Yeast)

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)

Sign In for Pricing
View Details
Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)
MBS1238540-05 0.02 mg (Baculovirus)

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)

Sign In for Pricing
View Details
Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)
MBS1238540-06 1 mg (E-Coli)

Recombinant Rhizopus oryzae FK506-binding protein 1 (FKBP1)

Sign In for Pricing
View Details