Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-45 , rat

Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

Product Specifications

Purity

≥95%

Molecular Weight

5040.79

Notes

For research use only.

AA Sequence

SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys23-Cys39)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOHH AAV Vector (Mouse) (CMV)
18505104 1 µg

DOHH AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
NARG1 Double Nickase Plasmid (h)
sc-405520-NIC 20 µg

NARG1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human LIPI shRNA (UAS) - Lentiviral human LIPI shRNA (UAS, GFP) plasmid
GTR15105802 1 Vial

Lentiviral human LIPI shRNA (UAS) - Lentiviral human LIPI shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RBM45, CT (RBM45, DRB1, DRBP1, RNA-binding protein 45, Developmentally-regulated RNA-binding protein 1, RNA-binding motif protein 45) (AP)
MBS6340817-01 0.2 mL

RBM45, CT (RBM45, DRB1, DRBP1, RNA-binding protein 45, Developmentally-regulated RNA-binding protein 1, RNA-binding motif protein 45) (AP)

Sign In for Pricing
View Details
RBM45, CT (RBM45, DRB1, DRBP1, RNA-binding protein 45, Developmentally-regulated RNA-binding protein 1, RNA-binding motif protein 45) (AP)
MBS6340817-02 5x 0.2 mL

RBM45, CT (RBM45, DRB1, DRBP1, RNA-binding protein 45, Developmentally-regulated RNA-binding protein 1, RNA-binding motif protein 45) (AP)

Sign In for Pricing
View Details
Anti-ALDH1A2 Antibody Picoband® Fluoro550 Conjugated
A04961-2-Fluoro550 100 µg/Vial

Anti-ALDH1A2 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details