Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-45 , rat

Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

Product Specifications

Purity

≥95%

Molecular Weight

5040.79

Notes

For research use only.

AA Sequence

SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys23-Cys39)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HB9 Double Nickase Plasmid (h2)
sc-402097-NIC-2 20 µg

HB9 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
LAD1 (E3Q8E) Rabbit Monoclonal Antibody
CST 76163T 20 µL

LAD1 (E3Q8E) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Nr2c1 (NM_011629) Mouse Tagged ORF Clone Lentiviral Particle
MR209201L4V 200 µL

Nr2c1 (NM_011629) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF329 Human shRNA Lentiviral Particle (Locus ID 79673)
TL300244V 500 µL Each

ZNF329 Human shRNA Lentiviral Particle (Locus ID 79673)

Sign In for Pricing
View Details
AKR1A1 Antibody - C-terminal region
ARP64535_P050-25UL 25 µL

AKR1A1 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein MLP2 (MLP2) , partial
MBS1098319 Inquire

Recombinant Saccharomyces cerevisiae Protein MLP2 (MLP2) , partial

Sign In for Pricing
View Details