Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRF (1 - 29), amide, human

GRF (1 - 29), amide, human

Product Specifications

Purity

≥95%

Molecular Weight

3358.03

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU5F1 (POU Class 5 Homeobox 1, MGC22487, OCT3, OCT4, OTF3, OTF4) (MaxLight 490)
250320-ML490 100 µL

POU5F1 (POU Class 5 Homeobox 1, MGC22487, OCT3, OCT4, OTF3, OTF4) (MaxLight 490)

Sign In for Pricing
View Details
Beta-Amyrin palmitate
orb2654928-01 50 mg

Beta-Amyrin palmitate

Sign In for Pricing
View Details
Beta-Amyrin palmitate
orb2654928-02 100 mg

Beta-Amyrin palmitate

Sign In for Pricing
View Details
Beta-Amyrin palmitate
orb2654928-03 5 mg

Beta-Amyrin palmitate

Sign In for Pricing
View Details
TRPC6 Rabbit Polyclonal Antibody (PE-Cy5)
orb883029 100 µL

TRPC6 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Recombinant Human CD33
MBS7617048-01 0.05 mg

Recombinant Human CD33

Sign In for Pricing
View Details