Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-Proinsulin C-Peptide (55-89) (human)

Tyr-C-Peptide is derived from genetically modified Arg32Tyr human pro-insulin mutants by trypsin and carboxypeptidase B codigestion.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

3780.24

Notes

For research use only.

AA Sequence

YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KSR2 Human Gene Knockout Kit (CRISPR)
KN211665RB 1 Kit

KSR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nociceptin receptor (OPRL1) (NM_000913) Human Over-expression Lysate
LC424459 20 µg

Nociceptin receptor (OPRL1) (NM_000913) Human Over-expression Lysate

Sign In for Pricing
View Details
PIK3CB (C-term) Rabbit Polyclonal Antibody
AP14931PU-N 400 µL

PIK3CB (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C1orf223 (TEX38) Human Gene Knockout Kit (CRISPR)
KN426877 1 Kit

C1orf223 (TEX38) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CNPY2 (NM_014255) Human Recombinant Protein
TP309441L 1 mg

CNPY2 (NM_014255) Human Recombinant Protein

Sign In for Pricing
View Details
APC2 Rabbit Polyclonal Antibody
AP23515PU-N 50 µg

APC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details