Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-Proinsulin C-Peptide (55-89) (human)

Tyr-C-Peptide is derived from genetically modified Arg32Tyr human pro-insulin mutants by trypsin and carboxypeptidase B codigestion.

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

3780.24

Notes

For research use only.

AA Sequence

YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zdhhc23 Mouse Gene Knockout Kit (CRISPR)
KN519688 1 Kit

Zdhhc23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), Biotin conjugate, 0.1mg/mL
BNCB0848-100 1x 100 µL

CD31 / PECAM-1 (C31.10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLK5 Polyclonal Antibody
E-AB-90848-01 60 µL

PLK5 Polyclonal Antibody

Sign In for Pricing
View Details
PLK5 Polyclonal Antibody
E-AB-90848-02 120 µL

PLK5 Polyclonal Antibody

Sign In for Pricing
View Details
PLK5 Polyclonal Antibody
E-AB-90848-03 200 µL

PLK5 Polyclonal Antibody

Sign In for Pricing
View Details
2-Linoleoyl-rac-glycerol-d5 O-TBS
TRC-L467966-2.5MG 2.5 mg

2-Linoleoyl-rac-glycerol-d5 O-TBS

Sign In for Pricing
View Details