Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1 - 40), amide, human

Equipotent to GHRF (1 - 40), amide, human in stimulating release of somatotropin from anterior pituitary; endogenous peptide originally found in human pancreatic tumor cells, but also seen in hypothalamus.

Product Specifications

Purity

≥95%

Molecular Weight

4543.14

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Acetate-13C,D3
TRC-S960210-50MG 50 mg

Sodium Acetate-13C,D3

Sign In for Pricing
View Details
Sodium Benzoate-d5
TRC-S614001-50MG 50 mg

Sodium Benzoate-d5

Sign In for Pricing
View Details
N-Butylscopolammonium Bromide
TRC-B693750-50MG 50 mg

N-Butylscopolammonium Bromide

Sign In for Pricing
View Details
Viva cDNA Synthesis Kit, 50app
cDSK01-050 50 applications

Viva cDNA Synthesis Kit, 50app

Sign In for Pricing
View Details
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: LT95]
AM03061RP-N 100 Tests

CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: LT95]

Sign In for Pricing
View Details
p-Chlorobenzyl Bromide-d6
TRC-C365997-5MG 5 mg

p-Chlorobenzyl Bromide-d6

Sign In for Pricing
View Details