Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1 - 40), amide, human

Equipotent to GHRF (1 - 40), amide, human in stimulating release of somatotropin from anterior pituitary; endogenous peptide originally found in human pancreatic tumor cells, but also seen in hypothalamus.

Product Specifications

Purity

≥95%

Molecular Weight

4543.14

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Hydroxy Camptothecin-d5
TRC-H875002-1MG 1 mg

10-Hydroxy Camptothecin-d5

Sign In for Pricing
View Details
Galectin 2 (LGALS2) (NM_006498) Human Recombinant Protein
TP309552L 1 mg

Galectin 2 (LGALS2) (NM_006498) Human Recombinant Protein

Sign In for Pricing
View Details
RPS6 Rabbit Polyclonal Antibody
AP06578PU-N 100 µg

RPS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Human CD329 Antibody[K8]
AN00319C-01 20 Tests

FITC Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details
FITC Anti-Human CD329 Antibody[K8]
AN00319C-02 100 Tests

FITC Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details
FITC Anti-Human CD329 Antibody[K8]
AN00319C-03 2x 100 Tests

FITC Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details