Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1 - 40), amide, human

Equipotent to GHRF (1 - 40), amide, human in stimulating release of somatotropin from anterior pituitary; endogenous peptide originally found in human pancreatic tumor cells, but also seen in hypothalamus.

Product Specifications

Purity

≥95%

Molecular Weight

4543.14

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Preactivated PE-Texas Red Maleimide
2716-AAT 1 mg

ReadiUse™ Preactivated PE-Texas Red Maleimide

Sign In for Pricing
View Details
TP53I11 Antibody
8C10041-AAT 50 µg

TP53I11 Antibody

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813P-01 25 µg

PE/Elab Fluor® 594 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813P-02 100 µg

PE/Elab Fluor® 594 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Y-27632 Dihydrochloride
TRC-D455443-50MG 50 mg

Y-27632 Dihydrochloride

Sign In for Pricing
View Details
Sodium Orthovanadate
TRC-S655003-100G 100 g

Sodium Orthovanadate

Sign In for Pricing
View Details