Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1 - 40), amide, human

Equipotent to GHRF (1 - 40), amide, human in stimulating release of somatotropin from anterior pituitary; endogenous peptide originally found in human pancreatic tumor cells, but also seen in hypothalamus.

Product Specifications

Purity

≥95%

Molecular Weight

4543.14

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester
TRC-D430985-2.5MG 2.5 mg

N,N'-(N,N'-Dicarboxy-L-cystyl)di-glycine Dibenzyl N,N'-Di-tert-butyl Ester

Sign In for Pricing
View Details
TMEM176B Human Gene Knockout Kit (CRISPR)
KN400802 1 Kit

TMEM176B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pellino 1 (PELI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H3]
TA807519AM 100 µL

Pellino 1 (PELI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details
Protein Phosphatase 2 A/B (B' pan 2) Rabbit Polyclonal Antibody
AP05045PU-N 100 µg

Protein Phosphatase 2 A/B (B' pan 2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), CF488A conjugate, 0.1mg/mL
BNC882410-100 1x 100 µL

STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP75 Polyclonal Antibody
E-AB-14142-01 20 µL

HSP75 Polyclonal Antibody

Sign In for Pricing
View Details