Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF (1 - 40), amide, human

Equipotent to GHRF (1 - 40), amide, human in stimulating release of somatotropin from anterior pituitary; endogenous peptide originally found in human pancreatic tumor cells, but also seen in hypothalamus.

Product Specifications

Purity

≥95%

Molecular Weight

4543.14

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPARCL1 (NM_001128310) Human Over-expression Lysate
LC426947 20 µg

SPARCL1 (NM_001128310) Human Over-expression Lysate

Sign In for Pricing
View Details
INDOL1 (IDO2) Mouse Monoclonal Antibody [Clone ID: OTI12G4]
CF806163 100 µg

INDOL1 (IDO2) Mouse Monoclonal Antibody [Clone ID: OTI12G4]

Sign In for Pricing
View Details
Water Chiller BCHI-210
BCHI-210 Each

Water Chiller BCHI-210

Sign In for Pricing
View Details
Mouse Fignl1 activation kit by CRISPRa
GA206399 1 Kit

Mouse Fignl1 activation kit by CRISPRa

Sign In for Pricing
View Details
HDAC5 (Ab-259) Antibody
8B0436-AAT 50 µg

HDAC5 (Ab-259) Antibody

Sign In for Pricing
View Details
(-)-5'-DMH-CBD
TRC-D494153-10MG 10 mg

(-)-5'-DMH-CBD

Sign In for Pricing
View Details