Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag, Carrier-free

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.

Product Specifications

Synonyms

SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP8, Nonstructural Protein 8

Reactivity

Mouse

Source

E. coli

Sequence

AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

Purification

> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.<br>Method of purification: Nickel column affinity purification

Endotoxin

Less than 1 EU/μg protein as determined by LAL method.

Form

Lyophilized

Components

Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose

Storage Conditions

The product is shipped at ambient temperature. Upon receipt, store it immediately at -20℃ for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Calculated Molecular Weight

22.7KD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-100 1x 100 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details