Big Endothelin-1 (1-31) (human, bovine)
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase.
Product Specifications
Field of Research
Epigenetics & Chromatin
Purity
≥95%
Molecular Weight
3628.16
Notes
For research use only.
AA Sequence
CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15; Cys3-Cys11)
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog