Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRF (1-29) amide (rat)

GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.

Product Specifications

Purity

≥95%

Solubility

Water: 16.67 mg/mL

Molecular Weight

3473.1

Notes

For research use only.

AA Sequence

HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit
MBS7209758-01 48 Well

Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit

Sign In for Pricing
View Details
Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit
MBS7209758-02 96 Well

Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit

Sign In for Pricing
View Details
Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit
MBS7209758-03 5x 96 Well

Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit

Sign In for Pricing
View Details
Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit
MBS7209758-04 10x 96 Well

Porcine Acetyl-CoA carboxylase 2 (ACACB) ELISA Kit

Sign In for Pricing
View Details
(1-Oxyl-2,2,5,5-tetramethylpyrroline-3-yl) carbamidoethyl Methanethiosulfonate (MTS-4-Oxyl)
O8243-07H 10 mg

(1-Oxyl-2,2,5,5-tetramethylpyrroline-3-yl) carbamidoethyl Methanethiosulfonate (MTS-4-Oxyl)

Sign In for Pricing
View Details
MPZL2 Antibody (Center)
orb1933808-01 50 µL

MPZL2 Antibody (Center)

Sign In for Pricing
View Details