Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepro-Neuromedin S (70-103) (human)

Prepro-Neuromedin S (70-103) (human)

Product Specifications

Purity

≥95%

Molecular Weight

3857.5

Notes

For research use only.

AA Sequence

FLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-500 1x 500 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF740 conjugate, 0.1mg/mL
BNC740774-100 1x 100 µL

HSP27 (HSPB1/774), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2782), CF405S conjugate, 0.1mg/mL
BNC042782-500 1x 500 µL

Calbindin 1 (CALB1) (CALB1/2782), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF647 conjugate, 0.1mg/mL
BNC471602-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details