Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRF (free acid) (human)

GRF (free acid) (human)

Product Specifications

Purity

≥95%

Molecular Weight

5040.74

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NGFI-B alpha/Nur77/NR4A1 Protein - (Dry Ice)
H00003164-P01-10ug 10 µg

Recombinant Human NGFI-B alpha/Nur77/NR4A1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Phf12 Rat Pre-designed siRNA Set A
HY-RS29236 1 Set

Phf12 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Caspase-10 Antibody
6677-30T 30 µg

Caspase-10 Antibody

Sign In for Pricing
View Details
Rat IgG1 (gamma 1 chain specific) Mouse Monoclonal Antibody [Clone ID: G1 7E7]
AM08090FC-N 500 µg

Rat IgG1 (gamma 1 chain specific) Mouse Monoclonal Antibody [Clone ID: G1 7E7]

Sign In for Pricing
View Details
Rfxap siRNA Oligos set (Rat)
38888176 3x 5 nmol

Rfxap siRNA Oligos set (Rat)

Sign In for Pricing
View Details
2-Bromo-4- (1,1-difluoroethyl) -1-fluorobenzene
NVB44485 2.5 g

2-Bromo-4- (1,1-difluoroethyl) -1-fluorobenzene

Sign In for Pricing
View Details