Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Endorphin, rat

β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction.

Product Specifications

Purity

≥95%

Molecular Weight

3466.09

Notes

For research use only.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Histone H3 (Citruline R2+R8+R17) Antibody
MBS4510001-01 0.05 mL

Rabbit anti-Histone H3 (Citruline R2+R8+R17) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H3 (Citruline R2+R8+R17) Antibody
MBS4510001-02 0.1 mL

Rabbit anti-Histone H3 (Citruline R2+R8+R17) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H3 (Citruline R2+R8+R17) Antibody
MBS4510001-03 5x 0.1 mL

Rabbit anti-Histone H3 (Citruline R2+R8+R17) Antibody

Sign In for Pricing
View Details
Manual Serological Controller, Blue
3375B 1 Each

Manual Serological Controller, Blue

Sign In for Pricing
View Details
Transferrin (Tf)
T8199-04N 100 µL

Transferrin (Tf)

Sign In for Pricing
View Details
ADRA1A (Adrenergic Receptor Alpha 1A, ADRA1C, ADRA1L1, ALPHA1AAR) (MaxLight 750)
MBS6405682-01 0.1 mL

ADRA1A (Adrenergic Receptor Alpha 1A, ADRA1C, ADRA1L1, ALPHA1AAR) (MaxLight 750)

Sign In for Pricing
View Details