Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Endorphin, rat

β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction.

Product Specifications

Purity

≥95%

Molecular Weight

3466.09

Notes

For research use only.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glyceraldehyde 3-Phosphate Dehydrogenase (GAPD, GAPDH) (HRP)
G8140-11B 1 mg

Glyceraldehyde 3-Phosphate Dehydrogenase (GAPD, GAPDH) (HRP)

Sign In for Pricing
View Details
C17orf85 Protein Vector (Human) (pPB-His-MBP)
PV329430 500 ng

C17orf85 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
KALA
orb1691409 5 mg

KALA

Sign In for Pricing
View Details
Recombinant Minichromosome Maintenance Deficient 3 Associated Protein (MCM3AP)
MBS2125600-01 0.01 mg

Recombinant Minichromosome Maintenance Deficient 3 Associated Protein (MCM3AP)

Sign In for Pricing
View Details
Recombinant Minichromosome Maintenance Deficient 3 Associated Protein (MCM3AP)
MBS2125600-02 0.05 mg

Recombinant Minichromosome Maintenance Deficient 3 Associated Protein (MCM3AP)

Sign In for Pricing
View Details
Recombinant Minichromosome Maintenance Deficient 3 Associated Protein (MCM3AP)
MBS2125600-03 0.1 mg

Recombinant Minichromosome Maintenance Deficient 3 Associated Protein (MCM3AP)

Sign In for Pricing
View Details