Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(β-Asp3) -GRF (human)

(β-Asp3) -GRF (human)

Product Specifications

Purity

≥95%

Molecular Weight

5039.65

Notes

For research use only.

AA Sequence

YA-{βAsp}-AIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF-alpha (APC1, Cachectin, Differentiation inducing factor, DIF, Macrophage cytotoxic factor, MCF, Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand superfamily member 2, Tumor Necrosis Factor Precursor) (APC)
172156-AF-APC 100 µL

TNF-alpha (APC1, Cachectin, Differentiation inducing factor, DIF, Macrophage cytotoxic factor, MCF, Necrosin, TNF alpha, TNF Macrophage Derived, TNF Monocyte Derived, TNF Superfamily Member 2, TNFA, TNFSF2, Tumor necrosis factor ligand superfamily member 2, Tumor Necrosis Factor Precursor) (APC)

Sign In for Pricing
View Details
Recombinant Erythropoietin (EPO)
MBS2009132-01 0.01 mg

Recombinant Erythropoietin (EPO)

Sign In for Pricing
View Details
Recombinant Erythropoietin (EPO)
MBS2009132-02 0.05 mg

Recombinant Erythropoietin (EPO)

Sign In for Pricing
View Details
Recombinant Erythropoietin (EPO)
MBS2009132-03 0.1 mg

Recombinant Erythropoietin (EPO)

Sign In for Pricing
View Details
Recombinant Erythropoietin (EPO)
MBS2009132-04 0.2 mg

Recombinant Erythropoietin (EPO)

Sign In for Pricing
View Details
Recombinant Erythropoietin (EPO)
MBS2009132-05 0.5 mg

Recombinant Erythropoietin (EPO)

Sign In for Pricing
View Details