Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(β-Asp3) -GRF (human)

(β-Asp3) -GRF (human)

Product Specifications

Purity

≥95%

Molecular Weight

5039.65

Notes

For research use only.

AA Sequence

YA-{βAsp}-AIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SelO Antibody
orb830124 2 mg

SelO Antibody

Sign In for Pricing
View Details
HDAC8 (Histone Deacetylase 8, HD 8, HD8, CDA07, Histone Deacetylase-like 1, HDACL1, CDA07, RPD3) (Not for Export EU)
127772 100 µL

HDAC8 (Histone Deacetylase 8, HD 8, HD8, CDA07, Histone Deacetylase-like 1, HDACL1, CDA07, RPD3) (Not for Export EU)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-6 (wnt6)
MBS1164112-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Protein Wnt-6 (wnt6)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-6 (wnt6)
MBS1164112-02 0.1 mg (E-Coli)

Recombinant Xenopus laevis Protein Wnt-6 (wnt6)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-6 (wnt6)
MBS1164112-03 0.02 mg (Yeast)

Recombinant Xenopus laevis Protein Wnt-6 (wnt6)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Protein Wnt-6 (wnt6)
MBS1164112-04 0.1 mg (Yeast)

Recombinant Xenopus laevis Protein Wnt-6 (wnt6)

Sign In for Pricing
View Details