Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(β-Asp3) -GRF (human)

(β-Asp3) -GRF (human)

Product Specifications

Purity

≥95%

Molecular Weight

5039.65

Notes

For research use only.

AA Sequence

YA-{βAsp}-AIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BHLHE41 sgRNA gene knockout kit - Lentiviral human BHLHE41 sgRNA gene knockout kit (plasmid)
GTR15376229 1 Vial

Lentiviral human BHLHE41 sgRNA gene knockout kit - Lentiviral human BHLHE41 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Lentiviral human LPO shRNA (UAS) - Lentiviral human LPO shRNA (UAS, RFP) (100)
GTR15124356 1 Vial

Lentiviral human LPO shRNA (UAS) - Lentiviral human LPO shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit
MBS9933800-01 48 Well

Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit

Sign In for Pricing
View Details
Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit
MBS9933800-02 96 Well

Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit

Sign In for Pricing
View Details
Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit
MBS9933800-03 5x 96 Well

Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit

Sign In for Pricing
View Details
Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit
MBS9933800-04 10x 96 Well

Sheep 4-Hydroxyphenylpyruvate Dioxygenase-Like Protein (HPDL) ELISA Kit

Sign In for Pricing
View Details