Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

(β-Asp3) -GRF (human)

(β-Asp3) -GRF (human)

Product Specifications

Purity

≥95%

Molecular Weight

5039.65

Notes

For research use only.

AA Sequence

YA-{βAsp}-AIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD3 rabbit pAb Antibody
orb2304876-01 50 µL

KCTD3 rabbit pAb Antibody

Sign In for Pricing
View Details
KCTD3 rabbit pAb Antibody
orb2304876-02 100 µL

KCTD3 rabbit pAb Antibody

Sign In for Pricing
View Details
Lentiviral human CCL28 shRNA (UAS) - Lentiviral human CCL28 shRNA (UAS, iRFP) plasmid
GTR15115708 1 Vial

Lentiviral human CCL28 shRNA (UAS) - Lentiviral human CCL28 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
0.2 ml Multo Rack
B10423 8 Racks

0.2 ml Multo Rack

Sign In for Pricing
View Details
Angiotensin II human acetate
orb1298833-01 5 mg

Angiotensin II human acetate

Sign In for Pricing
View Details
Angiotensin II human acetate
orb1298833-02 10 mg

Angiotensin II human acetate

Sign In for Pricing
View Details