Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1b (208-240) (human)

IL-1beta (208-240) can enhance non-REM sleep and elicit fever in rabbits. It increases PGE2 production by fibroblasts in vitro, but does not promote the proliferation of thymocytes.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4108.81

Notes

For research use only.

AA Sequence

KKKMEKRFVFNKIEINNKLEFESAQFPNWYIST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PF4V1 Peptide
DF16122-BP 1 mg

PF4V1 Peptide

Sign In for Pricing
View Details
CSGALNACT2 Antibody
36215 100 µL

CSGALNACT2 Antibody

Sign In for Pricing
View Details
Human Liver X Receptor β, LXRb ELISA Kit
CK-bio-13438-01 48 Tests

Human Liver X Receptor β, LXRb ELISA Kit

Sign In for Pricing
View Details
Human Liver X Receptor β, LXRb ELISA Kit
CK-bio-13438-02 96 Tests

Human Liver X Receptor β, LXRb ELISA Kit

Sign In for Pricing
View Details
Human Liver X Receptor β, LXRb ELISA Kit
CK-bio-13438-03 5x 96 Tests

Human Liver X Receptor β, LXRb ELISA Kit

Sign In for Pricing
View Details
Human Liver X Receptor β, LXRb ELISA Kit
CK-bio-13438-04 10x 96 Tests

Human Liver X Receptor β, LXRb ELISA Kit

Sign In for Pricing
View Details