Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1b (208-240) (human)

IL-1beta (208-240) can enhance non-REM sleep and elicit fever in rabbits. It increases PGE2 production by fibroblasts in vitro, but does not promote the proliferation of thymocytes.

Product Specifications

Field of Research

Immunology & Inflammation

Purity

≥95%

Molecular Weight

4108.81

Notes

For research use only.

AA Sequence

KKKMEKRFVFNKIEINNKLEFESAQFPNWYIST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT Antibody
orb571089-01 50 µg

MAPT Antibody

Sign In for Pricing
View Details
MAPT Antibody
orb571089-02 100 µg

MAPT Antibody

Sign In for Pricing
View Details
Chicken Anti-Cell free dna ELISA Kit
MBS7275183-01 48 Well

Chicken Anti-Cell free dna ELISA Kit

Sign In for Pricing
View Details
Chicken Anti-Cell free dna ELISA Kit
MBS7275183-02 96 Well

Chicken Anti-Cell free dna ELISA Kit

Sign In for Pricing
View Details
Chicken Anti-Cell free dna ELISA Kit
MBS7275183-03 5x 96 Well

Chicken Anti-Cell free dna ELISA Kit

Sign In for Pricing
View Details
Chicken Anti-Cell free dna ELISA Kit
MBS7275183-04 10x 96 Well

Chicken Anti-Cell free dna ELISA Kit

Sign In for Pricing
View Details