Prepro VIP (81-122), human

Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus.

Product Specifications

Purity

≥95%

Molecular Weight

4552.13

Notes

For research use only.

AA Sequence

HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS1429626-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Putative carbonic anhydrase-like protein 2 (cah-2)

View Details

MBS1429626-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Putative carbonic anhydrase-like protein 2 (cah-2)

View Details

MBS1429626-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Putative carbonic anhydrase-like protein 2 (cah-2)

View Details

MBS1429626-04 0.1 mg (Yeast)

Recombinant Caenorhabditis elegans Putative carbonic anhydrase-like protein 2 (cah-2)

View Details

MBS1429626-05 0.02 mg (Baculovirus)

Recombinant Caenorhabditis elegans Putative carbonic anhydrase-like protein 2 (cah-2)

View Details

MBS1429626-06 0.02 mg (Mammalian-Cell)

Recombinant Caenorhabditis elegans Putative carbonic anhydrase-like protein 2 (cah-2)

View Details