Prepro VIP (81-122), human
Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus.
Product Specifications
Purity
≥95%
Molecular Weight
4552.13
Notes
For research use only.
AA Sequence
HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1101038-01 0.05 mg (E-Coli)
Recombinant Conus pennaceus Omega-conotoxin PnVIA
Sign In for Pricing
View Details MBS1101038-02 0.2 mg (E-Coli)
Recombinant Conus pennaceus Omega-conotoxin PnVIA
Sign In for Pricing
View Details MBS1101038-03 0.05 mg (Yeast)
Recombinant Conus pennaceus Omega-conotoxin PnVIA
Sign In for Pricing
View Details MBS1101038-04 0.5 mg (E-Coli)
Recombinant Conus pennaceus Omega-conotoxin PnVIA
Sign In for Pricing
View Details