Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Endorphin, porcine

β-Endorphin, porcine

Product Specifications

Purity

≥95%

Molecular Weight

3424.01

Notes

For research use only.

AA Sequence

YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL1 / Delta-1 Protein (His Tag)
M60-081-L1000 1000 µg

DLL1 / Delta-1 Protein (His Tag)

Sign In for Pricing
View Details
Aminooxy-PEG3-bromide
HY-140396 1 Each

Aminooxy-PEG3-bromide

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701460 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Rabbit Anti Human P2RX4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8424410-01 0.12 mL

Rabbit Anti Human P2RX4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human P2RX4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8424410-02 0.2 mL

Rabbit Anti Human P2RX4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details
Rabbit Anti Human P2RX4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)
MBS8424410-03 5x 0.2 mL

Rabbit Anti Human P2RX4 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot, Immunofluorescence)

Sign In for Pricing
View Details