Glucagon-Like Peptide I (7-36), amide, human
Human glucagon-like peptide I amide fragment 7-36 was used in DMEM (Dulbeccos) medium to culture 3T3-L1 adipocytes to study the relationship between adipose tissue GLP-1 receptors and obesity and insulin resistance. GLP-1 (glucagon-like peptide 1) (7-36) amide is a potent insulinotropic peptide that initiates glucose-induced insulin release after a meal or oral glucose. It has antidiabetic effects, so it may be used to treat non-insulin-dependent diabetes.
Product Specifications
Field of Research
Pharmacology & Drug Discovery
Purity
≥95%
Molecular Weight
3297.7
Notes
For research use only.
AA Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog