Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-2 (1-33) (human)

GLP-2 (1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

Product Specifications

Purity

≥95%

Solubility

Water: 25mg/mL

Molecular Weight

3766.2

Notes

For research use only.

AA Sequence

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth and Differentiation Factor 9 (GDF9) (MaxLight 550)
MBS6419408-01 0.1 mL

Growth and Differentiation Factor 9 (GDF9) (MaxLight 550)

Sign In for Pricing
View Details
Growth and Differentiation Factor 9 (GDF9) (MaxLight 550)
MBS6419408-02 5x 0.1 mL

Growth and Differentiation Factor 9 (GDF9) (MaxLight 550)

Sign In for Pricing
View Details
Omadacycline Impurity 2
RM-O542002-01 10 mg

Omadacycline Impurity 2

Sign In for Pricing
View Details
Omadacycline Impurity 2
RM-O542002-02 25 mg

Omadacycline Impurity 2

Sign In for Pricing
View Details
Omadacycline Impurity 2
RM-O542002-03 50 mg

Omadacycline Impurity 2

Sign In for Pricing
View Details
Omadacycline Impurity 2
RM-O542002-04 100 mg

Omadacycline Impurity 2

Sign In for Pricing
View Details