Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-2 (1-33) (human)

GLP-2 (1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.

Product Specifications

Purity

≥95%

Solubility

Water: 25mg/mL

Molecular Weight

3766.2

Notes

For research use only.

AA Sequence

HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hSNF2H Double Nickase Plasmid (m2)
sc-430049-NIC-2 20 µg

hSNF2H Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rhox8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6020805 3x 1.0 µg

Rhox8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PAF49 (CD3EAP) (NM_012099) Human Tagged ORF Clone
RG214394 10 µg

PAF49 (CD3EAP) (NM_012099) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sestrin 3 (Sestrin-3, SESN3, SEST3) (MaxLight 550)
MBS6213908-01 0.1 mL

Sestrin 3 (Sestrin-3, SESN3, SEST3) (MaxLight 550)

Sign In for Pricing
View Details
Sestrin 3 (Sestrin-3, SESN3, SEST3) (MaxLight 550)
MBS6213908-02 5x 0.1 mL

Sestrin 3 (Sestrin-3, SESN3, SEST3) (MaxLight 550)

Sign In for Pricing
View Details
RBM26 siRNA (Mouse)
orb1840106-01 15 nmol

RBM26 siRNA (Mouse)

Sign In for Pricing
View Details