Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-gp41-Antigenic Peptide 5

HIV-gp41-Antigenic Peptide 5

Product Specifications

Field of Research

Infectious Disease & Virology

Purity

≥95%

Molecular Weight

4190.77

Notes

For research use only.

AA Sequence

RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2 (Disulfide bridge: Cys20-Cys26)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK8IP3 Polyclonal Antibody
E-AB-18142-01 20 µL

MAPK8IP3 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK8IP3 Polyclonal Antibody
E-AB-18142-02 60 µL

MAPK8IP3 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK8IP3 Polyclonal Antibody
E-AB-18142-03 120 µL

MAPK8IP3 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK8IP3 Polyclonal Antibody
E-AB-18142-04 200 µL

MAPK8IP3 Polyclonal Antibody

Sign In for Pricing
View Details
RPL18A (NM_000980) Human Over-expression Lysate
LY424426 100 µg

RPL18A (NM_000980) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR86 (C-term) Rabbit Polyclonal Antibody
AP54556PU-N 400 µL

WDR86 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details