Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (3-34) (bovine)

PTH (3-34) (bovine) is apTH ((Human parathyroid hormone) fragment.

Product Specifications

Purity

≥95%

Molecular Weight

3938.55

Notes

For research use only.

AA Sequence

SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2310079G19Rik Protein Vector (Mouse) (pPM-C-HA)
PV148144 500 ng

2310079G19Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RBM44 Human siRNA Oligo Duplex (Locus ID 375316)
SR317827 1 Kit

RBM44 Human siRNA Oligo Duplex (Locus ID 375316)

Sign In for Pricing
View Details
Mouse Monoclonal p27/Kip1 Antibody (KIP1/769) [DyLight 405]
NBP2-47769V 0.1 mL

Mouse Monoclonal p27/Kip1 Antibody (KIP1/769) [DyLight 405]

Sign In for Pricing
View Details
ZFPL1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-19136R-APC-Cy7 100 µL

ZFPL1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ZFPM1 Antibody
NBP2-88622 100 µL

Rabbit Polyclonal ZFPM1 Antibody

Sign In for Pricing
View Details
Guinea pig ovalbumin specific IgG, OVA sIgG ELISA Kit
YLA0022GP-01 48 Tests

Guinea pig ovalbumin specific IgG, OVA sIgG ELISA Kit

Sign In for Pricing
View Details