PTH (3-34) (bovine)
PTH (3-34) (bovine) is apTH ((Human parathyroid hormone) fragment.
Product Specifications
Purity
≥95%
Molecular Weight
3938.55
Notes
For research use only.
AA Sequence
SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EKU07779 96 Tests
Mouse Transcription Factor A, Mitochondrial (TFAM) ELISA Kit
Sign In for Pricing
View Details 
LV693824 1.0 µg DNA
STX6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 
032998-ML405 100 µL
C5AR1, ID (C5AR1, C5AR, C5R1, C5a anaphylatoxin chemotactic receptor, CD88) (MaxLight 405) discontinued
Sign In for Pricing
View Details MBS2012886-01 0.1 mL
FITC-linked Antibody to Toll Like Receptor 4 (TLR4)
Sign In for Pricing
View Details MBS2012886-02 0.2 mL
FITC-linked Antibody to Toll Like Receptor 4 (TLR4)
Sign In for Pricing
View Details