Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urotensin I

Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2β receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2β and mCRF2β receptors, respectively.

Product Specifications

Purity

≥95%

Molecular Weight

4869.55

Notes

For research use only.

AA Sequence

NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pop7 (NM_028753) Mouse Tagged ORF Clone
MG200880 10 µg

Pop7 (NM_028753) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TSPAN6 (NM_003270) Human Over-expression Lysate
LC401128 20 µg

TSPAN6 (NM_003270) Human Over-expression Lysate

Sign In for Pricing
View Details
CYB5R3 Recombinant Rabbit Monoclonal Antibody [JE63-51]
HA721008 100 µL

CYB5R3 Recombinant Rabbit Monoclonal Antibody [JE63-51]

Sign In for Pricing
View Details
1-Butylimidazole
TRC-B692300-50G 50 g

1-Butylimidazole

Sign In for Pricing
View Details
Recombinant Human WWP2 Protein (His & GST Tag)
PKSH030722 100 µg

Recombinant Human WWP2 Protein (His & GST Tag)

Sign In for Pricing
View Details
8-Chloro Caffeine
TRC-C364780-1G 1 g

8-Chloro Caffeine

Sign In for Pricing
View Details