Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urotensin I

Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2β receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2β and mCRF2β receptors, respectively.

Product Specifications

Purity

≥95%

Molecular Weight

4869.55

Notes

For research use only.

AA Sequence

NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BD2 (DEFB4A) Human Gene Knockout Kit (CRISPR)
KN419487 1 Kit

BD2 (DEFB4A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DYNLT2 Rabbit Polyclonal Antibody
TA369563 100 µL

DYNLT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Teflubenzuron
TRC-T013780-250MG 250 mg

Teflubenzuron

Sign In for Pricing
View Details
Slc2a8 Mouse Gene Knockout Kit (CRISPR)
KN516035 1 Kit

Slc2a8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EXD2 (NM_001193360) Human Over-expression Lysate
LC434339 20 µg

EXD2 (NM_001193360) Human Over-expression Lysate

Sign In for Pricing
View Details
Bbox1 Mouse Gene Knockout Kit (CRISPR)
KN501994 1 Kit

Bbox1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details