Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Urotensin I

Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2β receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2β and mCRF2β receptors, respectively.

Product Specifications

Purity

≥95%

Molecular Weight

4869.55

Notes

For research use only.

AA Sequence

NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pleura
CS501799 5x 5 µm

Frozen Tissue Sections, Pleura

Sign In for Pricing
View Details
GATM (NM_001482) Human Over-expression Lysate
LC419923 20 µg

GATM (NM_001482) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TLR2 (Toll-Like Receptor 2) CLIA Kit
E-CL-H0647-01 24 Tests

Human TLR2 (Toll-Like Receptor 2) CLIA Kit

Sign In for Pricing
View Details
Human TLR2 (Toll-Like Receptor 2) CLIA Kit
E-CL-H0647-02 48 Tests

Human TLR2 (Toll-Like Receptor 2) CLIA Kit

Sign In for Pricing
View Details
Human TLR2 (Toll-Like Receptor 2) CLIA Kit
E-CL-H0647-03 96 Tests

Human TLR2 (Toll-Like Receptor 2) CLIA Kit

Sign In for Pricing
View Details
PLA2R (PLA2R1) Mouse Monoclonal Antibody [Clone ID: OTI13F2]
CF815677 100 µg

PLA2R (PLA2R1) Mouse Monoclonal Antibody [Clone ID: OTI13F2]

Sign In for Pricing
View Details