Urotensin I
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2β receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2β and mCRF2β receptors, respectively.
Product Specifications
Purity
≥95%
Molecular Weight
4869.55
Notes
For research use only.
AA Sequence
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog