Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-1 (7-36) amide (chicken, common turkey)

Glucagon-Like Peptide 1 (GLP-1) is synthesized by posttranslational processing of proglucagon in the intestine and pancreas and plays an important role in metabolic homeostasis. Among the different molecular forms, such as GLP-1 (7-36) amide and GLP-1 (7-37), the function of GLP-1 (1-37) has been unclear. GLP-1 (1-37) was shown to convert intestinal epithelial cells into insulin-producing cells. These observations turned GLP-1 (1-37) into a new promising therapeutic compound for the treatment of diabetes mellitus. In animal models of dilated cardiomyopathy, hypertensive heart failure, and myocardial infarction, GLP-1 has shown a remarkable cardioprotective activity.

Product Specifications

Purity

≥95%

Molecular Weight

3327.69

Notes

For research use only.

AA Sequence

HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brilliant Violet 421™ anti-mouse CD45.2
GT01906 50 µg

Brilliant Violet 421™ anti-mouse CD45.2

Sign In for Pricing
View Details
Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit
MBS9346001-01 48 Well

Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit

Sign In for Pricing
View Details
Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit
MBS9346001-02 96 Well

Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit

Sign In for Pricing
View Details
Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit
MBS9346001-03 5x 96 Well

Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit

Sign In for Pricing
View Details
Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit
MBS9346001-04 10x 96 Well

Rat Lipid-Bound Sialic Acid (LSA) ELISA Kit

Sign In for Pricing
View Details
OS9 Antibody Blocking peptide
orb1453996 500 µg

OS9 Antibody Blocking peptide

Sign In for Pricing
View Details