GLP-1 (7-36) amide (chicken, common turkey)
Glucagon-Like Peptide 1 (GLP-1) is synthesized by posttranslational processing of proglucagon in the intestine and pancreas and plays an important role in metabolic homeostasis. Among the different molecular forms, such as GLP-1 (7-36) amide and GLP-1 (7-37), the function of GLP-1 (1-37) has been unclear. GLP-1 (1-37) was shown to convert intestinal epithelial cells into insulin-producing cells. These observations turned GLP-1 (1-37) into a new promising therapeutic compound for the treatment of diabetes mellitus. In animal models of dilated cardiomyopathy, hypertensive heart failure, and myocardial infarction, GLP-1 has shown a remarkable cardioprotective activity.
Product Specifications
Purity
≥95%
Molecular Weight
3327.69
Notes
For research use only.
AA Sequence
HAEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog