PTH (1-31) (human)
PTH (1-31) (human) is the 1-31 fragment of pTH (human) . pTH (1-31) (human) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. pTH (1-31) (human) induces bone formation without inducing bone resorption.pTH (1-31) (human) has the potential for the research of osteoporosis.
Product Specifications
Purity
≥95%
Molecular Weight
3719.35
Notes
For research use only.
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2040618-01 0.1 mL
FITC-Linked Polyclonal Antibody to Alpha-Fodrin (SPTAN1)
Sign In for Pricing
View Details