PTH (1-31) (human)
PTH (1-31) (human) is the 1-31 fragment of pTH (human) . pTH (1-31) (human) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. pTH (1-31) (human) induces bone formation without inducing bone resorption.pTH (1-31) (human) has the potential for the research of osteoporosis.
Product Specifications
Purity
≥95%
Molecular Weight
3719.35
Notes
For research use only.
AA Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RK07567 96 Tests
Human Transcriptional activator Myb (MYB) ELISA Kit
Sign In for Pricing
View Details