Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) (human)

PTH (1-31) (human) is the 1-31 fragment of pTH (human) . pTH (1-31) (human) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. pTH (1-31) (human) induces bone formation without inducing bone resorption.pTH (1-31) (human) has the potential for the research of osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

3719.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

petE Antibody, HRP conjugated
A51071-50UG 50 µg

petE Antibody, HRP conjugated

Sign In for Pricing
View Details
VEGF Receptor 3 Rabbit Monoclonal Antibody
E56G3374 100 µL

VEGF Receptor 3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
VGLL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV629245 1.0 µg DNA

VGLL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LGR6 Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated
orb3000574 100 µL

LGR6 Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated

Sign In for Pricing
View Details
SFRP1 (43-54) rabbit polyclonal antibody, Aff - Purified
AP07754PU-N 50 µg

SFRP1 (43-54) rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
Lentiviral mouse Gm5741 shRNA (UAS) - Lentiviral mouse Gm5741 shRNA (UAS, iRFP) plasmid
GTR15137812 1 Vial

Lentiviral mouse Gm5741 shRNA (UAS) - Lentiviral mouse Gm5741 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details