Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) (human)

PTH (1-31) (human) is the 1-31 fragment of pTH (human) . pTH (1-31) (human) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. pTH (1-31) (human) induces bone formation without inducing bone resorption.pTH (1-31) (human) has the potential for the research of osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

3719.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal E2F8 Antibody [DyLight 755]
NBP1-52650IR 0.1 mL

Rabbit Polyclonal E2F8 Antibody [DyLight 755]

Sign In for Pricing
View Details
Factor IX antibody
20R-FG001 10 mg

Factor IX antibody

Sign In for Pricing
View Details
HMG14 Antibody
MBS8509727-01 0.1 mg

HMG14 Antibody

Sign In for Pricing
View Details
HMG14 Antibody
MBS8509727-02 0.1 mL (AF635)

HMG14 Antibody

Sign In for Pricing
View Details
HMG14 Antibody
MBS8509727-03 0.1 mL (AF610)

HMG14 Antibody

Sign In for Pricing
View Details
HMG14 Antibody
MBS8509727-04 0.1 mL (AF405S)

HMG14 Antibody

Sign In for Pricing
View Details