Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-31) (human)

PTH (1-31) (human) is the 1-31 fragment of pTH (human) . pTH (1-31) (human) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. pTH (1-31) (human) induces bone formation without inducing bone resorption.pTH (1-31) (human) has the potential for the research of osteoporosis.

Product Specifications

Purity

≥95%

Molecular Weight

3719.35

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuf2 Rabbit mAb
MBS8603166-01 0.1 mL

Nuf2 Rabbit mAb

Sign In for Pricing
View Details
Nuf2 Rabbit mAb
MBS8603166-02 0.1 mL (AF405L)

Nuf2 Rabbit mAb

Sign In for Pricing
View Details
Nuf2 Rabbit mAb
MBS8603166-03 0.1 mL (AF405S)

Nuf2 Rabbit mAb

Sign In for Pricing
View Details
Nuf2 Rabbit mAb
MBS8603166-04 0.1 mL (AF610)

Nuf2 Rabbit mAb

Sign In for Pricing
View Details
Nuf2 Rabbit mAb
MBS8603166-05 0.1 mL (AF635)

Nuf2 Rabbit mAb

Sign In for Pricing
View Details
Nuf2 Rabbit mAb
MBS8603166-06 0.1 mL (APC)

Nuf2 Rabbit mAb

Sign In for Pricing
View Details